PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1266_f_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 297aa    MW: 33116.3 Da    PI: 7.7431
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1266_f_5genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-19136190256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Neem_1266_f_5 136 RKKLRLSKDQSAILEESFKEHNTLNPKQKMALAKQLGLRPRQVEVWFQNRRARTK 190
                    788899***********************************************98 PP

2HD-ZIP_I/II130.56.4e-42136225191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rlsk+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Neem_1266_f_5 136 RKKLRLSKDQSAILEESFKEHNTLNPKQKMALAKQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 225
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.8E-361110IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466896.27E-19127193IPR009057Homeodomain-like
PROSITE profilePS5007117.459132192IPR001356Homeobox domain
SMARTSM003891.0E-16134196IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.6E-19136190IPR009057Homeodomain-like
CDDcd000862.63E-16136193No hitNo description
PfamPF000461.2E-16136190IPR001356Homeobox domain
PRINTSPR000311.4E-5163172IPR000047Helix-turn-helix motif
PROSITE patternPS000270167190IPR017970Homeobox, conserved site
PRINTSPR000311.4E-5172188IPR000047Helix-turn-helix motif
PfamPF021832.3E-11192226IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-27192235IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MAEKDDLGLS LSLSFPQNHH SLQLNLMPPL VPSASSSSTP PGFCLGKPSW NQPFPSSDPN  60
SETCRAEARS FLRGIDVNRL PSQTDNEEEA GVSSPNSTIS SVSGKRSERE ANGEDNEIER  120
ACSRGISDEE DGDTSRKKLR LSKDQSAILE ESFKEHNTLN PKQKMALAKQ LGLRPRQVEV  180
WFQNRRARTK LKQTEVDCEF LKRCCENLTE ENRRLQKEVQ ELRALKLSPQ FYMQMTPPTT  240
LTMCPSCERV AVPPSSSAAV DPRPHQMAPR PIPINPWAPA AAPIHPHGPF DALRPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140SRKKLRL
2184192RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1347912e-63HM134791.1 Gossypium hirsutum homeodomain-leucine zipper protein HD2 (HB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039762.11e-176Homeobox-leucine zipper protein 4 / HD-ZIP protein
RefseqXP_012070041.11e-176PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-118HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A061G4E41e-176A0A061G4E4_THECC; Homeobox-leucine zipper protein 4 / HD-ZIP protein
TrEMBLA0A067L7241e-176A0A067L724_JATCU; Uncharacterized protein
STRINGPOPTR_0001s15490.11e-169(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15632690
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-111homeobox protein 2